In Vitro Technologies

E: care@invitro.com.au
P: 1300 552 003

Request a quote or demo
Contact a Specialist

LC3A Antibody Summary

Immunogen	A synthetic peptide made to an internal portion of the human LC3 protein sequence (between residues 25-121). [UniProt# Q9H492].
Localization	LC3-I is cytoplasmic. LC3-II binds to the autophagic membranes.
Marker	Autophagosome Marker
Specificity	This antibody detects both LC3A and LC3B.
Predicted Species	Bovine (100%), Xenopus (100%). Backed by our 100% Guarantee.
Isotype	IgG
Clonality	Polyclonal
Host	Rabbit
Gene	MAP1LC3A
Purity	Immunogen affinity purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase.Learn about the Innovator's Reward

Applications/Dilutions

Dilutions

Western Blot
Simple Western 1:50
ELISA
Flow Cytometry
Immunoblotting
Immunocytochemistry/Immunofluorescence 1:100-1:300
Immunohistochemistry 1:200-1:400
Immunohistochemistry-Frozen
Immunohistochemistry-Paraffin 1:200-1:400
Immunoprecipitation 20 ug / 500 ug of lysate
Southern Blot

Application Notes

This LC3 antibody is useful for Western blot, Immunocytochemistry (PMID 21545732), Immunoprecipitation and Immunohistochemistry in paraffin embedded sections. By Western blot bands are seen at ~19 kDa, representing LC3-I, and ~17 kDa, representing LC3-II. In ICC, cytoplasmic staining was observed in HeLa cells. Use in FLOW cytometry reported in scientific literature ( PMID 24419333). Use in ELISA reported in scientific literature (PMID 20930550). Use in southern blot reported in scientific literature (PMID 21262964).Use in immunoblotting reported in scientific literature (PMID 28253371). In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.

Positive Control

LC3B Lysate (NBL1-12844)
Brain Lysate (NB820-59657)
Brain Lysate (NB820-59177)
Neuro2a Lysate (NBP2-19017)
Neuro2a Lysate (NBP2-49688)
HeLa Lysate (NBP2-49689)

Reviewed Applications

Read 18 Reviews rated 4.3 using NB100-2331 in the following applications:

Western Blot
Immunofluorescence
Immunohistochemistry-Paraffin
Immunohistochemistry

Publications

Read Publications using NB100-2331 in the following applications:

ELISA 2 publications
FLOW 1 publication
IB 1 publication
ICC/IF 29 publications
IHC 7 publications
IHC-Fr 5 publications
IHC-P 2 publications
IP 3 publications
WB 125 publications
WB,IP 1 publication

Reactivity Notes

Human, mouse, rat and Zebrafish. Fish reactivity reported in scientific literature (PMID: 25522711). Predicted to react with Xenopus and bovine based on 100% sequence homology. Canine reactivity reported in scientific literature (PMID: 26179070). Plant reactivity reported in scientific literature (PMID: 27861739).

Packaging, Storage & Formulations

Storage	Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer	PBS
Preservative	0.02% Sodium Azide
Concentration	1.0 mg/ml
Purity	Immunogen affinity purified

Alternate Names for LC3A Antibody

Apg8
APG8a
Apg8p3
ATG8E
Autophagy-related protein LC3 A
Autophagy-related ubiquitin-like modifier LC3 A
LC3
LC3A
lc3-i, ii
MAP1A/1B light chain 3 A
MAP1ALC3
MAP1ALC3MAP1A/MAP1B LC3 A
MAP1BLC3MAP1A/MAP1B light chain 3 A
MAP1LC3A
microtubule-associated protein 1 light chain 3 alphaMAP1 light chain 3-like protein 1
microtubule-associated proteins 1A/1B light chain 3
microtubule-associated proteins 1A/1B light chain 3A
MLP3A

Background

LC3 (microtubule-associated protein light chain 3), the most studied autophagy biomarker, was originally identified as a subunit of microtubule-associated proteins 1A and 1B (MAP1LC3) and was later found to contain similarity to yeast protein Apg8/Aut7/Cvt5. Distributed ubiquitously in eukaryotes, LC3 is expressed as 3 splice variants/isoforms (LC3A, LC3B and LC3C) which undergo post-translational processing, wherein, the unprocessed form of LC3 is proteolytically cleaved by Atg4 protease to form LC3-I with carboxyterminal exposed glycine. During autophagy, this exposed glycine of LC3-I is conjugated by Atg7 (an E1-like activity), Atg3 (an E2-like conjugating activity) and by Atg12-Atg5-Atg16L multimers (E3-like ligase activity) to phosphatidylethanolamine (PE) moiety for generating LC3-II. The lipophilic character of PE group facilitates LC3-II insertion into autophagosomes membranes, and as a result LC3-II is degraded when autophagosomes fuse with lysosomes to form autolysosomes for lysus of intra-autophagosomal components by lysosomal hydrolases. Conversion of LC3I to LC3II when correlated with autophagosome numbers is considered as the best marker of autophagy because LC3-II is the only well-characterized protein which specifically localize to autophagic structures throughout autophagy (from phagophore to lysosomal degradation). LC3 is a great tool in research as autophagy is implicated in numerous physiological/pathological processes including responses to exercise/aging, cancer, metabolic and neurodegenerative disorders, and cardiovascular/pulmonary diseases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LC3A Antibody (NB100-2331)(209)

We have publications tested in 7 confirmed species: Human, Mouse, Rat, Canine, Fish, Plant, Zebrafish.We have publications tested in 10 applications: ELISA, FLOW, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB, WB,IP. Submit a Publication Filter By Application ELISA (2) FLOW (1) IB (1) ICC/IF (29) IHC (7) IHC-Fr (5) IHC-P (2) IP (3) WB (125) WB,IP (1) All Applications Filter By Species Human (69) Mouse (55) Rat (8) Canine (1) Fish (2) Plant (1) Zebrafish (5) All Species Showing Publications 1 - 10 of 209. Show All 209 Publications. Collapse Publications.

Publications using NB100-2331	Applications	Species
Saera-Vila A, Kish PE, Kahana A. Autophagy in Zebrafish Extraocular Muscle Regeneration Methods Mol. Biol. May 24 2018 [PMID: 29797006] (Zebrafish)		Zebrafish
Chmielewska M, Dedukh D, Haczkiewicz K et al. The programmed DNA elimination and formation of micronuclei in germ line cells of the natural hybridogenetic water frog Pelophylax esculentus Sci Rep May 18 2018 [PMID: 29777142] (ICC/IF)	ICC/IF
Lim H, Lim YM, Kim KH et al. A novel autophagy enhancer as a therapeutic agent against metabolic syndrome and diabetes. Nat Commun Apr 12 2018 [PMID: 29650965] (WB, Human)	WB	Human
Anunobi R, Boone BA, Cheh N et al. Extracellular DNA promotes colorectal tumor cell survival after cytotoxic chemotherapy. J. Surg. Res. Jun 1 2018 [PMID: 29605400] (WB, ICC/IF)	WB, ICC/IF
Jeong AL, Ka HI, Han S et al. Oncoprotein CIP2A promotes the disassembly of primary cilia and inhibits glycolytic metabolism. EMBO Rep. Feb 28 2018 [PMID: 29491003] (WB)	WB
Piacentini M, Baiocchini A, Del Nonno F, Melino G. Non-alcoholic fatty liver disease severity is modulated by transglutaminase type 2. Cell Death Dis. 2018 Feb 15 [PMID: 29449533] (WB, Mouse)	WB	Mouse
Inomata Y, Nagasaka S, Miyate K, Goto Y. Bcl-2-associated athanogene 3 (BAG3) is an enhancer of small heat shock protein turnover via activation of autophagy in the heart. Biochem. Biophys. Res. Commun. 2018 Feb 19 [PMID: 29409895] (WB, Mouse)	WB	Mouse
Festa BP, Chen Z, Berquez M et al. Impaired autophagy bridges lysosomal storage disease and epithelial dysfunction in the kidney Nat Commun 2018 Jan 11 [PMID: 29323117] (WB, Zebrafish)	WB	Zebrafish
Watanabe S, Komine O, Endo F et al. Intracerebroventricular administration of Cystatin C ameliorates disease in SOD1-linked amyotrophic lateral sclerosis mice. J. Neurochem. 2017 Dec 28 [PMID: 29282717] (WB, Mouse)	WB	Mouse
Palucci I, Matic I, Falasca L et al. Transglutaminase type 2 plays a key role in the pathogenesis of Mycobacterium tuberculosis infection. J. Intern. Med. 2017 Dec 04 [PMID: 29205566] (Mouse)		Mouse
Minakaki G, Menges S, Kittel A et al. Autophagy inhibition promotes SNCA/alpha-synuclein release and transfer via extracellular vesicles with a hybrid autophagosome-exosome-like phenotype. Autophagy 2017 Dec 04 [PMID: 29198173] (WB, Mouse)	WB	Mouse
Jiang MY, Han ZD, Li W et al. Mitochondrion-associated protein peroxiredoxin 3 promotes benign prostatic hyperplasia through autophagy suppression and pyroptosis activation Oncotarget. 2017 Oct 06 [PMID: 29113303] (WB, Human)	WB	Human
Desseille C, Deforges S, Biondi O et al. Specific Physical Exercise Improves Energetic Metabolism in the Skeletal Muscle of Amyotrophic-Lateral-Sclerosis Mice. Frontiers in Molecular Neuroscience. 2017 Oct 20 [PMID: 29104532] (WB, Mouse)	WB	Mouse
Theofilas P, Ehrenberg AJ, Nguy A et al. Probing the correlation of neuronal loss, neurofibrillary tangles, and cell death markers across the Alzheimer's disease Braak stages: a quantitative study in humans. Neurobiol. Aging. 2017 Sep 20 [PMID: 29031088] (ICC/IF, IHC, Human)	ICC/IF, IHC	Human
Kaverina N, Borovjagin AV, Kadagidze Z et al. Astrocytes promote progression of breast cancer metastases to the brain via a KISS1-mediated autophagy. Autophagy. 2017 Oct 05 [PMID: 28981380] (ICC/IF)	ICC/IF
Solanas G, Peixoto FO, Perdiguero E et al. Aged Stem Cells Reprogram Their Daily Rhythmic Functions to Adapt to Stress Cell 2017 Aug 10 [PMID: 28802040] (Mouse)		Mouse
Benitez BA, Sands MS. Primary fibroblasts from CSPalpha mutation carriers recapitulate hallmarks of the adult onset neuronal ceroid lipofuscinosis Sci Rep 2017 Jul 24 [PMID: 28740222] (WB, Human)	WB	Human
Nazim UM, Moon JH, Lee YJ et al. PPARy activation by troglitazone enhances human lung cancer cells to TRAIL-induced apoptosis via autophagy flux. Oncotarget Apr 18 2017 [PMID: 28460464] (WB, Human)	WB	Human
Bae SY, Byun S, Bae SH et al. TPT1 (tumor protein, translationally-controlled 1) negatively regulates autophagy through the BECN1 interactome and an MTORC1-mediated pathway. Autophagy. Feb 15 2017 [PMID: 28409693] (WB, Mouse)	WB	Mouse
Yue F, Li W, Zou J et al. Spermidine prolongs lifespan and prevents liver fibrosis and hepatocellular carcinoma by activating MAP1S-mediated autophagy. Cancer Res. Apr 6 2017 [PMID: 28386016] (WB, Human)	WB	Human
Lopez A, Lee SE, Wojta K et al. A152T tau allele causes neurodegeneration that can be ameliorated in a zebrafish model by autophagy induction. Brain. Feb 9 2017 [PMID: 28334843] (WB, Fish)	WB	Fish
Mattoscio D, Casadio C, Miccolo C et al. Autophagy regulates UBC9 levels during viral-mediated tumorigenesis. PLoS Pathog. Mar 1 2017 [PMID: 28253371] (IB, Human)	IB	Human
Garcia-Prat L, Munoz-Canoves P, Martinez-Vicente M. Monitoring Autophagy in Muscle Stem Cells. Methods Mol. Biol. Mar 1 2017 [PMID: 28247355] (Mouse)		Mouse
Schulze U, Vollenbroker B, Kuhnl A et al. Cellular vacuolization caused by overexpression of the PIKfyve-binding deficient Vac14(L156R) is rescued by starvation and inhibition of vacuolar-ATPase. Biochim. Biophys. Acta. 2017 Feb 16 [PMID: 28216340] (ICC/IF)	ICC/IF
Suzuki J, Nakajima W, Suzuki H et al. Chaperone-mediated autophagy promotes lung cancer cell survival through selective stabilization of the pro-survival protein, MCL1. Biochem. Biophys. Res. Commun. Dec 7 2016 [PMID: 27939888] (WB, Human)	WB	Human
Lu Y, Liu XF, Liu TR et al. Celecoxib exerts antitumor effects in HL-60 acute leukemia cells and inhibits autophagy by affecting lysosome function. Biomed. Pharmacother. Nov 21 2016 [PMID: 27884749] (Human)		Human
Lee S-, Kang J-, Kim S- et al. Afzelin ameliorates Dgalactosamine and lipopolysaccharideinduced fulminant hepatic failure by modulating mitochondrial quality control and dynamics. British Journal of Pharmacology. Nov 15 2016 [PMID: 27861739] (WB, Mouse, Plant)	WB	Mouse, Plant
Shingu T, Ho AL, Yuan L et al. Qki deficiency maintains stemness of glioma stem cells in suboptimal environment by downregulating endolysosomal degradation. Nat. Genet. Nov 14 2016 [PMID: 27841882] (WB, Mouse)	WB	Mouse
Jiang C, Jin S, Jiang Z, Wang J. Inhibitory effects of silibinin on proliferation and lung metastasis of human high metastasis cell line of salivary gland adenoid cystic carcinoma via autophagy induction. Onco Targets Ther. Nov 8 2016 [PMID: 27822066] (Mouse)		Mouse
Zhang D, Pan J, Xiang X et al. Protein Kinase Cdelta Suppresses Autophagy to Induce Kidney Cell Apoptosis in Cisplatin Nephrotoxicity. J. Am. Soc. Nephrol. Oct 31 2016 [PMID: 27799485]
Song X, Xie Y, Kang R et al. FANCD2 protects against bone marrow injury from ferroptosis. Biochem. Biophys. Res. Commun. Nov 18 2016 [PMID: 27773819]
Liu P, Jin H, Guo Z et al. Silver nanoparticles outperform gold nanoparticles in radiosensitizing U251 cells in vitro and in an intracranial mouse model of glioma. Int J Nanomedicine. Oct 19 2016 [PMID: 27757033] (ICC/IF, Human)	ICC/IF	Human
Benvenuto M, Mattera R, Masuelli L et al. Gossypol induces apoptosis and autophagy in head and neck carcinoma cell lines and inhibits the growth of transplanted salivary gland cancer cells in BALB/c mice. Int J Food Sci Nutr Sep 27 2016 [PMID: 27670669]
Morell C, Bort A, Vara-Ciruelos D et al. Up-Regulated Expression of LAMP2 and Autophagy Activity during Neuroendocrine Differentiation of Prostate Cancer LNCaP Cells PLoS ONE Sep 15 2016 [PMID: 27627761] (WB, Human)	WB	Human
Yamada E, Okada S, Bastie CC et al. Fyn phosphorylates AMPK to inhibit AMPK activity and AMP-dependent activation of autophagy. Oncotarget Sep 8 2016 [PMID: 27626315]
Mo Zt, Li Wn, Zhai Yr, Gong Qh. Icariin Attenuates OGD/R-Induced Autophagy via Bcl-2-Dependent Cross Talk between Apoptosis and Autophagy in PC12 Cells. Evid Based Complement Alternat Med. Jul 25 2016 [PMID: 27610184] (WB)	WB
Caccamo A, Ferreira E, Branca C, Oddo S p62 improves AD-like pathology by increasing autophagy. Mol. Psychiatry 2016 Aug 30 [PMID: 27573878]
Saini NK, Baena A, Ng TW et al. Suppression of autophagy and antigen presentation by Mycobacterium tuberculosis PE_PGRS47. Nat Microbiol. Aug 26 2016 [PMID: 27562263] (WB, Mouse)	WB	Mouse
Tan KP, Ho MY, Cho HC et al. Fucosylation of LAMP-1 and LAMP-2 by FUT1 correlates with lysosomal positioning and autophagic flux of breast cancer cells. Cell Death Dis. Aug 26 2016 [PMID: 27560716] (ICC/IF, Human)	ICC/IF	Human
Sun X, Sun L, Zhao Y et al. MAVS maintains mitochondrial homeostasis via autophagy. Cell Discov. Aug 23 2016 [PMID: 27551434] (IP, WB, Human)	IP, WB	Human
Sabha N, Volpatti JR, Gonorazky H et al. PIK3C2B inhibition improves function and prolongs survival in myotubular myopathy animal models. J. Clin. Invest. Sep 1 2016 [PMID: 27548528] (WB, Mouse)	WB	Mouse
Hong JM, Kim SJ, Lee SM. Role of necroptosis in autophagy signaling during hepatic ischemia and reperfusion. Toxicol. Appl. Pharmacol. Aug 10 2016 [PMID: 27521978] (WB)	WB
Jiuju Du, Wencheng Zhu, Li Yang et al. Reduction of polyethylenimine-coated iron oxide nanoparticles induced autophagy and cytotoxicity by lactosylation. Oxford Academics 2016 Jun 12 [PMID: 27482464] (WB, Mouse)	WB	Mouse
Granato M, Zompetta C, Vescarelli E et al. HCV derived from sera of HCV-infected patients induces pro-fibrotic effects in human primary fibroblasts by activating GLI2. Sci Rep. Aug 1 2016 [PMID: 27476557] (WB, Human)	WB	Human
Wu HM, Wang J, Zhang B et al. CpG-ODN promotes phagocytosis and autophagy through JNK/P38 signal pathway in Staphylococcus aureus-stimulated macrophage. Life Sci. Jul 27 2016 [PMID: 27476088] (WB, Mouse)	WB	Mouse
Saera-Vila A, Kish PE, Louie KW et al. Autophagy Regulates Cytoplasmic Remodeling During Cell Reprogramming in a Zebrafish Model of Muscle Regeneration. Autophagy. Jul 28 2016 [PMID: 27467399] (WB, Zebrafish)	WB	Zebrafish
Suzuki K, Yamaguchi A, Yamanaka S et al. Accumulated a-synuclein affects the progression of GM2 gangliosidoses Exp. Neurol. 2016 Jul 21 [PMID: 27453479]
Lee HY, Kim J, Quan W et al. Autophagy deficiency in myeloid cells increases susceptibility to obesity-induced diabetes and experimental colitis. Autophagy Jun 23 2016 [PMID: 27337687] (WB)	WB
Erbil S, Oral O, Mitou G et al. RACK1 is an Interaction Partner of ATG5 and a Novel Regulator of Autophagy. J. Biol. Chem. Jun 20 2016 [PMID: 27325703] (WB)	WB
Hossini AM, Quast AS, Plotz M et al. PI3k/AkT Signaling Pathway Is Essential for Survival of Induced Pluripotent Stem Cells. PLoS ONE. May 4 2016 [PMID: 27138223] (WB, Human)	WB	Human
Piras A, Collin L, Gruninger F et al. Autophagic and lysosomal defects in human tauopathies: analysis of post-mortem brain from patients with familial Alzheimer disease, corticobasal degeneration and progressive supranuclear palsy. Acta Neuropathol Commun 2016 Mar 02 [PMID: 26936765] (WB)	WB
Pema M, Drusian L, Chiaravalli M et al. mTORC1-mediated inhibition of polycystin-1 expression drives renal cyst formation in tuberous sclerosis complex. Nat Commun 2016 Mar 02 [PMID: 26931735] (WB)	WB
Jacob F, Yonis AY, Cuello F et al. Analysis of Tyrosine Kinase Inhibitor-Mediated Decline in Contractile Force in Rat Engineered Heart Tissue. PLoS One 2016 Feb 03 [PMID: 26840448] (WB)	WB
Buhler A, Kustermann M, Bummer T et al. Atrogin-1 Deficiency Leads to Myopathy and Heart Failure in Zebrafish. Int J Mol Sci 2016 Jan 30 [PMID: 26840306] (WB)	WB
Li W, Zou J, Yue F et al. Defects in MAP1S-mediated autophagy cause reduction in mouse lifespans especially when fibronectin is overexpressed. Aging Cell. 2016 Jan 10 [PMID: 26750654] (WB, Mouse)	WB	Mouse
Garcia-Prat L, Martinez-Vicente M, Perdiguero E et al. Autophagy maintains stemness by preventing senescence. Nature. 2016 Jan 07 [PMID: 26738589] (WB, ICC/IF, Mouse)	WB, ICC/IF	Mouse
Altuntas S, Rossin F, Marsella C et al. The transglutaminase type 2 and pyruvate kinase isoenzyme M2 interplay in autophagy regulation. Oncotarget 2015 Dec 29 [PMID: 26702927] (WB)	WB
Duarte-Silva S, Silva-Fernandes A, Neves-Carvalho A et al. Combined therapy with m-TOR-dependent and -independent autophagy inducers causes neurotoxicity in a mouse model of Machado-Joseph disease. Neuroscience. 2015 Nov 19 [PMID: 26601773] (WB, Mouse)	WB	Mouse
Song K, Hu W, Yue F et al. Transforming Growth Factor TGFbeta Increases Levels of Microtubule-Associated Protein MAP1S and Autophagy Flux in Pancreatic Ductal Adenocarcinomas. PLoS ONE. 2015 Nov 17 [PMID: 26571030] (IHC-P, Human)	IHC-P	Human
Muhammad E, Levitas A, Singh SR et al. PLEKHM2 mutation leads to abnormal localization of lysosomes, impaired autophagy flux and associates with recessive dilated cardiomyopathy and left ventricular noncompaction. Hum Mol Genet 2015 Dec 20 [PMID: 26464484] (Human)		Human
Xiong R, Zhou W, Siegel D et al. A Novel Hsp90 Inhibitor Activates Compensatory Heat Shock Protein Responses and Autophagy and Alleviates Mutant A53T alpha-Synuclein Toxicity. Mol Pharmacol 2015 Dec [PMID: 26405178] (Human)		Human
Grossi V, Lucarelli G, Forte G et al. Loss of STK11 expression is an early event in prostate carcinogenesis and predicts therapeutic response to targeted therapy against MAPK/p38. Autophagy 2015 Sep 21 [PMID: 26391455] (WB, Human)	WB	Human
Daniels CMLP, Paffenroth E, Austin EV, Glebov K. Lithium Decreases Glial Fibrillary Acidic Protein in a Mouse Model of Alexander Disease. PloS one 2015 Sep 17 [PMID: 26378915] (WB, Mouse)	WB	Mouse
Humphrey SA. DNA damage and oxidative stress induced-p53 activity in astrocytes causes growth arrest. 2012 University of Western Ontario.
Chen Q, Yue F, Li W et al. Potassium Bisperoxo (1,10-phenanthroline) Oxovanadate (bpV(phen)) Induces Apoptosis and Pyroptosis and Disrupts the P62-HDAC6 Interaction to Suppress the Acetylated Microtubule-dependent Degradation of Autophagosomes. J. Biol. Chem. 2015 Sep 11 [PMID: 26363065] (WB, Human, Mouse)	WB	Human, Mouse
Zhen Y, Li W. Impairment of autophagosome-lysosome fusion in the buff mutant mice with the VPS33A(D251E) mutation. Autophagy. 2015 Aug 11 [PMID: 26259518] (WB, Mouse)	WB	Mouse
Pomilio C, Pavia P, Gorojod RM et al. Glial alterations from early to late stages in a model of alzheimer's disease: Evidence of autophagy involvement in Abeta internalization. Hippocampus. 2015 Aug 01 [PMID: 26235241] (IHC, Mouse)	IHC	Mouse
Irimia JM, Tagliabracci VS, Meyer CM et al. Muscle glycogen remodeling and glycogen phosphate metabolism following exhaustive exercise of wild type and laforin knockout mice. J. Biol. Chem. 2015 Jul 27 [PMID: 26216881] (WB, Mouse)	WB	Mouse
Kabak YB, Sozmen M, Yarim M et al. Immunohistochemical detection of autophagy-related microtubule-associated protein 1 light chain 3 (LC3) in the cerebellums of dogs naturally infected with canine distemper virus Biotech Histochem. 2015 Jul 16 [PMID: 26179070] (IHC-P, Canine)	IHC-P	Canine
Gorojod RM, Alaimo A, Porte Alcon S et al. The autophagic- lysosomal pathway determines the fate of glial cells under manganese- induced oxidative stress conditions Free Radic. Biol. Med. 2015 Jul 07 [PMID: 26163003] (IHC-Fr, Rat)	IHC-Fr	Rat
Chia-Wei Lin, Ming-Shiou Jan, Jung-Hua Steven Kuo. Exploring MicroRNA Expression Profiles Related to the mTOR Signaling Pathway in Mouse Embryonic Fibroblast Cells Treated with Polyethylenimine. Mol Pharm. 2015 Aug 3 [PMID: 26158199]
Nabissi M, Morelli MB, Amantini C et al. Cannabidiol stimulates Aml-1a-dependent glial differentiation and inhibits glioma stem-like cells proliferation by inducing autophagy in a TRPV2-dependent manner. Int. J. Cancer. 2015 Apr 22 [PMID: 25903924] (WB, Human)	WB	Human
Wang T, Martin S, Papadopulos A et al. Control of autophagosome axonal retrograde flux by presynaptic activity unveiled using botulinum neurotoxin type a J. Neurosci. 2015 Apr 15 [PMID: 25878289] (WB, ICC/IF, Rat)	WB, ICC/IF	Rat
Ulasov IV, Shah N, Kaverina NV et al. Tamoxifen improves cytopathic effect of oncolytic adenovirus in primary glioblastoma cells mediated through autophagy Oncotarget 2015 Feb 28 [PMID: 25738357] (WB, Human)	WB	Human
Wei Y, An Z, Zou Z et al. The stress-responsive kinases MAPKAPK2/MAPKAPK3 activate starvation-induced autophagy through Beclin 1 phosphorylation Elife. 2015 Feb 19 [PMID: 25693418] (WB, Human)	WB	Human
Zou J, Li W, Misra A et al. Viral Restriction Factor Tetherin Prevents Leucine-rich Pentatricopeptide Repeat Containing Protein (LRPPRC) from Association with Beclin 1 and B-cell CLL/lymphoma 2 (Bcl-2) and Enhances Autophagy and Mitophagy J. Biol. Chem. 2015 Jan 28 [PMID: 25631043] (WB, Human)	WB	Human
Nuschke A, Rodrigues M, Stolz DB et al. Human mesenchymal stem cells/multipotent stromal cells consume accumulated autophagosomes early in differentiation. Stem Cell Res Ther. 2014 Dec 17 [PMID: 25523618] (WB, Human)	WB	Human
Wilson WN, Baumgarner BL, Watanabe WO et al. Effects of resveratrol on growth and skeletal muscle physiology of juvenile southern flounder. Comp. Biochem. Physiol., Part A Mol. Integr. Physiol. 2014 Dec 16 [PMID: 25522711] (WB, Fish)	WB	Fish
Varga M, Fodor E, Vellai T. Autophagy in zebrafish. Methods. 2014 Dec 09 [PMID: 25498006] (WB, Zebrafish)	WB	Zebrafish
Cicchini M, Chakrabarti R, Kongara S et al. Autophagy regulator BECN1 suppresses mammary tumorigenesis driven by WNT1 activation and following parity. Autophagy 2014 Oct 30 [PMID: 25483966] (IHC)	IHC
Gan M, Moussaud S, Jiang P, Mclean Pj. Extracellular ATP induces intracellular alpha-synuclein accumulation via P2X1 receptor-mediated lysosomal dysfunction Neurobiology of Aging et al. 2014 Nov 05 [PMID: 25480524] (WB, Human)Details:LC3/MAP1LC3A antibody used for WB on lysates of S1S2 cells (derived from founder H4/Tetoff cells) and differentiated Lund human mesencephalic/Luhmes cells treated or not with 3 mM ATP or 200 nM bafilomycin A1 for 48 hours (Fig. 6B and Fig. 6E).	WB	Human
Carlisi D, Lauricella M, D'Anneo A et al. The synergistic effect of SAHA and Parthenolide in MDA-MB231 breast cancer cells J. Cell. Physiol. 2014 Nov 05 [PMID: 25370819] (WB, Human)Details:LC3 antibody used for WB on MDA-MB231 breast cancer cells treated or not with suberoylanilide hydroxamic acid (SAHA, an histone deacetylase inhibitor), sesquiterpene lactone Parthenolide (Pn) and bafilomycin A1 (BafA1, a powerful inhibitor of the autophagic flux). WB data is shown in Figure 3b.	WB	Human
Rohailla S, Clarizia N, Sourour M et al. Acute, Delayed and Chronic Remote Ischemic Conditioning Is Associated with Downregulation of mTOR and Enhanced Autophagy Signaling. PLoS OnE. 2014 Oct 28 [PMID: 25347774] (WB, Mouse)	WB	Mouse
Lim YM, Lim H, Hur KY et al. Systemic autophagy insufficiency compromises adaptation to metabolic stress and facilitates progression from obesity to diabetes. Nat Commun. 2014 Sep 26 [PMID: 25255859]
Oliverio S, Corazzari M, Sestito C et al. The spermidine analogue GC7 (N1-guanyl-1,7-diamineoheptane) induces autophagy through a mechanism not involving the hypusination of eIF5A. Amino Acids. 2014 Sep 14 [PMID: 25218134]
Xiong R, Siegel D, Ross D. Quinone-induced protein handling changes: Implications for major protein handling systems in quinone-mediated toxicity. Toxicol. Appl. Pharmacol. 2014 Aug 22 [PMID: 25151970] (WB, ICC/IF, Rat)	WB, ICC/IF	Rat
Guglielmotto M, Monteleone D, Piras A et al. Abeta1-42 monomers or oligomers have different effects on autophagy and apoptosis. Autophagy 2014 Oct 1 [PMID: 25136804] (WB)	WB
Duarte-Silva S, Neves-Carvalho A, Soares-Cunha C et al. Lithium Chloride Therapy Fails to Improve Motor Function in a Transgenic Mouse Model of Machado-Joseph Disease. Cerebellum. 2014 Aug 12 [PMID: 25112410] (WB, Mouse)	WB	Mouse
Cai-McRae X, Zhong H, Karantza V. Sequestosome 1/p62 facilitates HER2-induced mammary tumorigenesis through multiple signaling pathways. Oncogene. 2014 Aug 04 [PMID: 25088198]
Lin CW, Jan MS, Kuo JH. Autophagy-related gene expression analysis of wild-type and atg5 gene knockout mouse embryonic fibroblast cells treated with polyethylenimine. Mol Pharm. 2014 Sep 2 [PMID: 25075440]
Li J, Rohailla S, Gelber N et al. MicroRNA-144 is a circulating effector of remote ischemic preconditioning. Basic Res. Cardiol. 2014 Sep 01 [PMID: 25060662] (WB, Mouse)Details:LC3 antibody used for WB in hearts from mice injected with PBS, miR-Co or miR-144 (Figure 2b).	WB	Mouse
Barmada SJ, Serio A, Arjun A et al. Autophagy induction enhances TDP43 turnover and survival in neuronal ALS models. Nat. Chem. Biol. 2014 Jun 29 [PMID: 24974230] (ICC/IF, Rat)	ICC/IF	Rat
Heijnen Harry F, van Wijk Richard, Pereboom Tamara C et al. Ribosomal protein mutations induce autophagy through S6 kinase inhibition of the insulin pathway. PLoS Genet. 2014 May 29 [PMID: 24875531] (WB)	WB
Perluigi M, Pupo G, Tramutola A et al. Neuropathological role of PI3K/Akt/mTOR axis in Down syndrome brain. Biochim. Biophys. Acta 2014 Apr 13 [PMID: 24735980] (WB, Human)	WB	Human
Zou J, Yue F, Li W et al. Autophagy Inhibitor LRPPRC Suppresses Mitophagy through Interaction with Mitophagy Initiator Parkin. PLoS ONE 2014 Apr 11 [PMID: 24722279] (WB, Human)	WB	Human
Schonewolf CA, Mehta M, Schiff D et al. Autophagy inhibition by chloroquine sensitizes HT-29 colorectal cancer cells to concurrent chemoradiation. World J Gastrointest Oncol 3/15/2014 [PMID: 24653797] (WB, Human)	WB	Human
Zhang L, Chen X, Sharma P et al. HACE1-dependent protein degradation provides cardiac protection in response to haemodynamic stress. Nat Commun 3/11/2014 [PMID: 24614889] (WB, Mouse)	WB	Mouse
Lozy F, Cai-McRae X, Teplova I et al. ERBB2 overexpression suppresses stress-induced autophagy and renders ERBB2-induced mammary tumorigenesis independent of monoallelic Becn1 loss. Autophagy 2014 Apr [PMID: 24492513] (WB)	WB
Clarke AJ, Ellinghaus U, Cortini A et al. Autophagy is activated in systemic lupus erythematosus and required for plasmablast development. Ann. Rheum. Dis. 2014 Jan 13 [PMID: 24419333] (FLOW, Mouse)	FLOW	Mouse
Korkmaz G, Tekirdag KA, Ozturk DG et al. MIR376A Is a Regulator of Starvation-Induced Autophagy. PLoS One 2013 Dec 16 [PMID: 24358205] (WB, Human)	WB	Human
Yuzefovych LV, Ledoux SP, Wilson GL, Rachek LI. Mitochondrial DNA Damage via Augmented Oxidative Stress Regulates Endoplasmic Reticulum Stress and Autophagy: Crosstalk, Links and Signaling. PLoS One 2013 Dec 13 [PMID: 24349491] (WB, Rat)	WB	Rat
Sanjurjo L, Amezaga N, Vilaplana C et al. The Scavenger Protein Apoptosis Inhibitor of Macrophages (AIM) Potentiates the Antimicrobial Response against Mycobacterium tuberculosis by Enhancing Autophagy. PLoS One. 2013 Nov 4 [PMID: 24223991] (WB, ICC/IF, Human)	WB, ICC/IF	Human
D'Anneo A, Carlisi D, Lauricella M et al. Parthenolide generates reactive oxygen species and autophagy in MDA-MB231 cells. A soluble parthenolide analogue inhibits tumour growth and metastasis in a xenograft model of breast cancer. Cell Death Dis. 2013 Oct 31 [PMID: 24176849] (WB, Human)	WB	Human
Hollomon MG, Gordon N, Santiago-O Farrill JM et al. Knockdown of autophagy-related protein 5, ATG5, decreases oxidative stress and has an opposing effect on camptothecin-induced cytotoxicity in osteosarcoma cells. BMC Cancer. 2013 Oct 26 [PMID: 24160177] (WB, Mouse)	WB	Mouse
Seront E, Boidot R, Bouzin C et al. Tumour hypoxia determines the potential of combining mTOR and autophagy inhibitors to treat mammary tumours. Br J Cancer. 2013 Nov 12 [PMID: 24157830] (WB, ICC/IF, IHC-Fr, Human, Mouse)	WB, ICC/IF, IHC-Fr	Human, Mouse
Wang J, Yang K, Zhou L et al. MicroRNA-155 Promotes Autophagy to Eliminate Intracellular Mycobacteria by Targeting Rheb. PLoS Pathog. 2013 Oct [PMID: 24130493] (ICC/IF, WB, Mouse)	ICC/IF, WB	Mouse
Lin F, Zhu J, Tonnesen MG et al. Fibronectin Peptides that Bind PDGF-BB Enhance Survival of Cells and Tissue under Stress. J Invest Dermatol. 2013 Oct 14 [PMID: 24126844] (ELISA, WB, Mouse)	ELISA, WB	Mouse
Zhao J, Li Z, Wang M et al. Manipulation of autophagy by HCMV infection is involved in mTOR and influences the replication of virus. Acta Biochim Biophys Sin (Shanghai). 2013 Nov [PMID: 24108761] (WB, Human)	WB	Human
Budina-Kolomets Anna, Balaburski Gregor M, Bondar Anastasia et al. Comparison of the activity of three different HSP70 inhibitors on apoptosis, cell cycle arrest, autophagy inhibition, and HSP90 inhibition. Cancer Biol Ther. 2014 Feb 01 [PMID: 24100579] (Human)		Human
Devereaux K, Dall'armi C, Alcazar-Roman A et al. Regulation of Mammalian Autophagy by Class II and III PI 3-Kinases through PI3P Synthesis. PLoS One. 2013 Oct 3 [PMID: 24098492] (WB, Mouse)	WB	Mouse
Lee IH, Yun J, Finkel T. The emerging links between sirtuins and autophagy. Methods Mol Biol 2013 [PMID: 24014412]
Cufi S, Vazquez-Martin A, Oliveras-Ferraros C et al. The anti-malarial chloroquine overcomes Primary resistance and restores sensitivity to Trastuzumab in HER2-positive breast cancer. Sci Rep. 2013 Aug 22 [PMID: 23965851] (WB, ICC/IF, Human)	WB, ICC/IF	Human
Budina-Kolomets A, Hontz RD, Pimkina J, Murphy ME A conserved domain in exon 2 coding for the human and murine ARF tumor suppressor protein is required for autophagy induction. Autophagy 2013 Oct [PMID: 23939042] (WB)	WB
Eaves-Pyles T, Patel J, Arigi E et al. Immunomodulatory and Antibacterial Effects of Cystatin 9 against Francisella tularensis. Mol Med. 2013 Aug 28 [PMID: 23922243] (ICC/IF, WB, Human)	ICC/IF, WB	Human
Zou J, Yue F, Jiang X et al. Mitochondrion-associated protein LRPPRC suppresses the initiation of basal levels of autophagy via enhancing Bcl-2 stability. Biochem J 2013 Jul 3 [PMID: 23822101] (WB, Human)	WB	Human
Wang W, Kang J, Li H et al. Regulation of endoplasmic reticulum stress in rat cortex by p62/ZIP through the Keap1-Nrf2-ARE signalling pathway after transient focal cerebral ischaemia. Brain Inj 2013 [PMID: 23782269] (WB, Rat)	WB	Rat
Chen JJ, Long ZJ, Xu DF et al. Inhibition of autophagy augments the anticancer activity of a -mangostin in chronic myeloid leukemia cells. Taylor Francis. 2014 Mar [PMID: 23734655] (WB, Human)	WB	Human
Xiong R, Siegel D, Ross D. The activation sequence of cellular protein handling systems after proteasomal inhibition in dopaminergic cells. Chem Biol Interact 2013 May 14 [PMID: 23684743] (WB, Rat)	WB	Rat
Palmio J, Evila A, Chapon f et al. Hereditary myopathy with early respiratory failure: occurrence in various populations. J Neurol Neurosurg Psychiatry 2013 Apr 19 [PMID: 23606733]
Di Domenico F, Coccia R, Cocciolo A et al. Impairment of proteostasis network in Down syndrome prior to the development of Alzheimer's disease neuropathology: Redox proteomics analysis of Human brain. Biochim Biophys Acta 2013 Apr 17 [PMID: 23603808] (WB, Human)	WB	Human
Chen MC, Chen CH, Liu YN et al. TW01001, a novel piperazinedione compound, induces mitotic arrest and autophagy in non-small cell lung cancer A549 cells. Cancer Lett 2013 Apr 6 [PMID: 23567646] (WB, Human)	WB	Human
Martin S, Harper CB, May LM et al. Inhibition of PIKfyve by YM-201636 Dysregulates Autophagy and Leads to Apoptosis-Independent Neuronal Cell Death PLoS One 2013 [PMID: 23544129] (WB, Mouse)	WB	Mouse
Rowe I, Chiaravalli M, Mannella V et al. Defective glucose metabolism in polycystic kidney disease identifies a new therapeutic strategy Nat Med 2013 Apr [PMID: 23524344] (WB, Mouse)	WB	Mouse
Drerup CM, Nechiporuk AV. JNK-Interacting Protein 3 Mediates the Retrograde Transport of Activated c-Jun N-Terminal Kinase and Lysosomes. PLoS Genet 2013 Feb [PMID: 23468645] (WB, IHC, ICC/IF, Zebrafish)	WB, IHC, ICC/IF	Zebrafish
Chiou SK, Hoa N, Ge L, Jadus MR. Nutrient Availability Alters the Effect of Autophagy on Sulindac Sulfide-Induced Colon Cancer Cell Apoptosis. Gastroenterol Res Pract. 2012 [PMID: 23431290] (WB, Human)	WB	Human
Xie X, White EP, Mehnert JM. Coordinate Autophagy and mTOR Pathway Inhibition Enhances Cell Death in Melanoma. PLoS One 2013 [PMID: 23383069] (WB, Human)	WB	Human
Teplova I, Lozy F, Price S et al. ATG proteins mediate efferocytosis and suppress inflammation in mammary involution. Autophagy 2013 Apr 1 [PMID: 23380905] (IHC, Mouse)	IHC	Mouse
Shoji-Kawata S, Sumpter R, Leveno M et al. Identification of a candidate therapeutic autophagy-inducing peptide. Nature 2013 Feb 14 [PMID: 23364696] (WB, Human)	WB	Human
Choi BY, Jang BG, Kim JH et al. Copper/zinc chelation by clioquinol reduces spinal cord white matter damage and behavioral deficits in a murine MOG-induced multiple sclerosis model. Neurobiol Dis 2013 Jan 26 [PMID: 23360710] (IHC-Fr, ICC/IF, WB, Mouse)	IHC-Fr, ICC/IF, WB	Mouse
Jiang TF, Zhang YJ, Zhou HY et al. Curcumin Ameliorates the Neurodegenerative Pathology in A53T alpha-synuclein Cell Model of Parkinson's Disease Through the Downregulation of mTOR/p70S6K Signaling and the Recovery of Macroautophagy. J Neuroimmune Pharmacol 2013 Jan 17 [PMID: 23325107] (WB, ICC/IF, Human)	WB, ICC/IF	Human
Balaburski GM, Leu JI, Beeharry N et al. A Modified HSP70 Inhibitor Shows Broad Activity as an Anticancer Agent. Mol Cancer Res 2013 Mar [PMID: 23303345] (WB, Human)	WB	Human
Momma K, Noguchi S, Malicdan MC et al. Rimmed vacuoles in becker muscular dystrophy have similar features with inclusion myopathies PLoS One 2012 [PMID: 23251671] (IHC, ICC/IF, Human)	IHC, ICC/IF	Human
Jena P, Mohanty S, Mohanty T et al. Azurophil granule proteins constitute the major mycobactericidal proteins in human neutrophils and enhance the killing of mycobacteria in macrophages PLoS One 2012 [PMID: 23251364] (ICC/IF, Human)	ICC/IF	Human
Martinet W, Schrijvers DM, Timmermans JP et al. Immunohistochemical analysis of macroautophagy: recommendations and limitations. Autophagy 2013 Mar [PMID: 23242143] (Mouse)		Mouse
Sulzmaier FJ, Li Z, Nakashige ML et al. AD65, GAD67, and GABAT Immunostaining in Human Brain and Apparent GAD65 Loss in Alzheimer's Disease PLoS One 2012 [PMID: 23144724] (WB, Human)	WB	Human
Nakagawa S, Nishihara K, Inui KI, Masuda S. Involvement of autophagy in the pharmacological effects of the mTOR inhibitor everolimus in acute kidney injury Eur J Pharmacol 2012 Sep 26 [PMID: 23022334] (WB, IHC-Fr, ICC/IF, Rat)	WB, IHC-Fr, ICC/IF	Rat
Lin CW, Jan MS, Kuo JH et al. Protective role of autophagy in branched polyethylenimine (25K)- and poly(L-lysine) (30-70K)-induced cell death. Eur J Pharm Sci. 2012 Dec 18 [PMID: 23000135]
Cyrino LT, Araujo AP, Joazeiro PP et al. In vivo and in vitro Leishmania amazonensis infection induces autophagy in macrophages Tissue Cell 2012 Aug 30 [PMID: 22939777] (WB, ICC/IF, Mouse)	WB, ICC/IF	Mouse
He C, Sumpter R Jr, Levine B. Exercise induces autophagy in peripheral tissues and in the brain Autophagy. 2012 Oct [PMID: 22892563] (WB, Mouse)	WB	Mouse
Joselin AP, Hewitt SJ, Callaghan SM et al. ROS-dependent regulation of Parkin and DJ-1 localization during oxidative stress in neurons Hum Mol Genet 2012 Aug 23 [PMID: 22872702] (ICC/IF, Mouse)	ICC/IF	Mouse
Ramos FJ, Chen SC, Garelick MG et al. Rapamycin Reverses Elevated mTORC1 Signaling in Lamin A/C-Deficient Mice, Rescues Cardiac and Skeletal Muscle Function, and Extends Surviva Sci Transl Med. 2012 Jul 25 [PMID: 22837538]
Garcia-Garcia A, Rodriguez-Rocha H, Tseng MT et al. E2F-1 lacking the transcriptional activity domain induces autophagy Cancer Biol Ther 2012 Sep 1 [PMID: 22825328]
Erwin DP, Nydam SD, Call DR. Vibrio parahaemolyticus ExsE is requisite for initial adhesion and subsequent type III secretion system 1-dependent autophagy in HeLa cells Microbiology 2012 Sep [PMID: 22767546] (WB, Human)	WB	Human
Grkovic S, O'Reilly VC, Han S et al. IGFBP-3 binds GRP78, stimulates autophagy and promotes the survival of breast cancer cells exposed to adverse microenvironments Oncogene 2012 Jul 2 [PMID: 22751133] (WB, Human)	WB	Human
Eijiro Yamada, Claire C Bastie, Hiroshi Koga, Yichen Wang, Ana Maria Cuervo, Jeffrey E Pessin. Mouse Skeletal Muscle Fiber-Type-Specific Macroautophagy and Muscle Wasting Are Regulated by a Fyn/STAT3/Vps34 Signaling Pathway. Cell Reports, 10.1016/j.celrep.03.014. 2012 [PMID: 22745922] (WB, Mouse)	WB	Mouse
Claerhout S, Dutta B, Bossuyt W et al. Abortive Autophagy Induces Endoplasmic Reticulum Stress and Cell Death in Cancer Cells PLoS One 2012 [PMID: 22745748] (WB, Human)	WB	Human
Garcia AG, Wilson RM, Heo J et al. Interferon-gamma ablation exacerbates myocardial hypertrophy in diastolic heart failure Am J Physiol Heart Circ Physiol 2012 Sep [PMID: 22730392] (WB, Mouse)	WB	Mouse
Schaeffer V, Lavenir I, Ozcelik S et al. Stimulation of autophagy reduces neurodegeneration in a mouse model of human tauopathy Brain 2012 Jun 10 [PMID: 22689910] (WB, ICC/IF)	WB, ICC/IF
Klucken J, Poehler AM, Ebrahimi-Fakhari D et al. Alpha-synuclein aggregation involves a bafilomycin A 1-sensitive autophagy pathway Autophagy 2012 May 1 [PMID: 22647715]
Aoyagi T, Kusakari Y, Xiao CY et al. Cardiac mTOR protects the heart against ischemia-reperfusion injury Am J Physiol Heart Circ Physiol 2012 Jul [PMID: 22561297] (WB, Mouse)	WB	Mouse
Li L, Zhu YQ, Jiang L, Peng W. Increased autophagic activity in senescent human dental pulp cells. Int Endod J. 2012 Apr 6. [PMID: 22551517] (WB, Human)	WB	Human
Liang X, De Vera ME, Buchser WJ et al. Inhibiting Systemic Autophagy during Interleukin 2 Immunotherapy Promotes Long-term Tumor Regression Cancer Res 2012 Jun 1 [PMID: 22472122] (IHC-Fr, ICC/IF, WB, Mouse)	IHC-Fr, ICC/IF, WB	Mouse
Vangestel C, Van de Wiele C, Mees G et al. Single-photon emission computed tomographic imaging of the early time course of therapy-induced cell death using technetium 99m tricarbonyl His-annexin A5 in a colorectal cancer xenograft model. Mol Imaging 2012 Apr [PMID: 22469241]
Choi KE, Hall CL, Sun JM et al. A novel stroke therapy of pharmacologically induced hypothermia after focal cerebral ischemia in mice. FASEB J 2012 Jul [PMID: 22459147] (WB, Mouse)	WB	Mouse
Zheng F, Yang WJ, Sun KJ, Wan XM, Man N, Wen LP. Hoechst 33342-induced autophagy protected HeLa cells from caspase-independent cell death with the participation of ROS. Free Radic Res. 2012 Mar 20. [PMID: 22375792] (WB, Human)	WB	Human
Martinet W, Verheye S, De Meyer I, Timmermans JP, Schrijvers DM, Van Brussel I, Bult H, De Meyer GR. Everolimus triggers cytokine release by macrophages: rationale for stents eluting everolimus and a glucocorticoid. Arterioscler Thromb Vasc Biol;32(5):1228-35. 2012 May. [PMID: 22345170] (WB, Mouse)	WB	Mouse
Schwartz RE, Trehan K, Andrus L, Sheahan TP, Ploss A, Duncan SA, Rice CM, Bhatia SN. Modeling hepatitis C virus infection using human induced pluripotent stem cells. Proc Natl Acad Sci U S A;109(7):2544-8. 2012 Feb 14. [PMID: 22215441]
Cufi S, Vazquez-Martin A, Oliveras-Ferraros C et al. Autophagy positively regulates the CD44(+) CD24(-/low) breast cancer stem-like phenotype. Cell Cycle 2011 Nov 15 [PMID: 22127234] (Human)		Human
Zhang X, Yuan Q, Tang W et al. Substrate-Favored Lysosomal and Proteasomal Pathways Participate in the Normal Balance Control of Insulin Precursor Maturation and Disposal in [beta]-Cells. PLoS ONE 20116(11). [PMID: 22102916]
Ohmi K, Zhao H-Z, Neufeld EF. Defects in the medial entorhinal cortex and dentate gyrus in the mouse model of Sanfilippo syndrome type B. PLoS ONE 20116(11). [PMID: 22096577]
Zois CE, Giatromanolaki A, Sivridis E et al. Autophagic flux in normal mouse tissues: focus on endogenous LC3A processing. Autophagy 2011 Nov [PMID: 21997374]
D'Agostino C, Nogalska A, Cacciottolo M, Engel WK, Askanas V. Abnormalities of NBR1, a novel autophagy-associated protein, in muscle fibers of sporadic inclusion-body myositis. Acta Neuropathol;122(5):627-36. 2011 Nov. [PMID: 21935636] (IP, Human)	IP	Human
Kuo T-C, Chen C-T, Baron D et al. Midbody accumulation through evasion of autophagy contributes to cellular reprogramming and tumorigenicity. Nat Cell Biol;13(10):1214-23. 2011 Sep 11. [PMID: 21909099]
Yuan M, Huang Z, Wei D et al. Identification of Autographa californica nucleopolyhedrovirus ac93 as a core gene and its requirement for intranuclear microvesicle formation and nuclear egress of nucleocapsids. J Virol 2011 Nov [PMID: 21880748]
Lichtenberg M, Mansilla A, Zecchini VR et al. The ParkinsonÃ¢Â€Â™s disease protein LRRK2 impairs proteasome substrate clearance without affecting proteasome catalytic activity. Cell Death Dis. 2011 [PMID: 21866175]
Tomaras GD, Binley JM, Gray ES et al. Polyclonal B cell responses to conserved neutralization epitopes in a subset of HIV-1-infected individuals. J Virol 2011 Nov [PMID: 21849452] (ICC/IF)	ICC/IF
Dortet L, Mostowy S, Louaka AS et al. Recruitment of the Major Vault Protein by InlK: A Listeria monocytogenes Strategy to Avoid Autophagy. PLoS Pathog;7(8):e1002168. 2011 Aug. [PMID: 21829365]
Meng Q, Cai D. Defective hypothalamic autophagy directs the central pathogenesis of obesity via the IkappaB kinase beta (IKKbeta)/NF-kappaB pathway. J Biol Chem. Sep. 2011 [PMID: 21784844]
Mostowy S, Sancho-Shimizu V, Hamon M et al. p62 and NDP52 target Intracytosolic Shigella and Listeria to different autophagy pathways. J Biol Chem. 2011 Jun 6. [PMID: 21646350]
Shahnazari S, Namolovan A, Mogridge J et al. Bacterial toxins can inhibit host cell autophagy through cAMP generation. Autophagy 2011 Sep [PMID: 21606683]
Rodriguez-Rocha H, Gomez-Gutierrez JG, Garcia-Garcia A et al. Adenoviruses induce autophagy to promote virus replication and oncolysis. Virology 2011 Jul 20 [PMID: 21575980] (IP)	IP
Fazio EN, Dimattia GE, Chadi SA et al. Stanniocalcin 2 alters PERK signaling and reduces cellular injury during cerulein induced pancreatitis in mice. BMC Cell Biol;12:17. 2011 May 5. [PMID: 21545732]
Jiang S, Li Y, Zhu YH, Wu XQ, Tang J, Li Z, Feng GK, Deng R, Li DD, Luo RZ, Zhang MF, Qin W, Wang X, Jia WH, Zhu XF. Intensive expression of UNC-51-like kinase 1 is a novel biomarker of poor prognosis in patients with esophageal squamous cell carcinoma. Cancer Sci;102(8):1568-75. 2011 Aug. [PMID: 21518141] (WB, Human)	WB	Human
Rossin F, D'Eletto M, Macdonald D, Farrace MG, Piacentini M. TG2 transamidating activity acts as a reostat controlling the interplay between apoptosis and autophagy. Amino Acids;42(5):1793-802. 2012 May. [PMID: 21479826] (WB, Mouse)	WB	Mouse
Jorge CD, Ventura R, Maycock C et al. Assessment of the efficacy of solutes from extremophiles on protein aggregation in cell models of Huntington's and Parkinson's diseases. Neurochem Res 2011 Jun [PMID: 21416120] (WB, Human)	WB	Human
von Haefen C, Sifringer M, Menk M, Spies CD. Ethanol enhances susceptibility to apoptotic cell death via down-regulation of autophagy-related proteins. Alcohol Clin Exp Res;35(8):1381-91. 2011 Aug. [PMID: 21410490] (WB, ICC/IF, Human)	WB, ICC/IF	Human
Uddin MN, Nishio N, Ito S, Suzuki H, Isobe K. Autophagic activity in thymus and liver during aging. Age (Dordr);34(1):75-85. 2012 Feb. [PMID: 21387084] (IHC, Mouse)	IHC	Mouse
Tang Y-C, Williams BR, Siegel JJ, Amon A. Identification of Aneuploidy-Selective Antiproliferation Compounds. Cell;144(4):499-512. 2011 Feb 18. [PMID: 21315436]
Dammer EB, Na CH, Xu P et al. Polyubiquitin linkage profiles in three models of proteolytic stress suggest the etiology of Alzheimer disease J Biol Chem 2011 Mar [PMID: 21278249] (ICC/IF, Human)	ICC/IF	Human
Xie R, Nguyen S, McKeehan K et al. Microtubule-associated protein 1S (MAP1S) bridges autophagic components with microtubules and mitochondria to affect autophagosomal biogenesis and degradation. J Biol Chem 2011 Mar 25 [PMID: 21262964] (WB,IP)	WB,IP
Hsu HS, Huang PI, Chang YL et al. Cucurbitacin I inhibits tumorigenic ability and enhances radiochemosensitivity in nonsmall cell lung cancer-derived CD133-positive cells. Cancer. Jul. 2011 [PMID: 21225866] (WB, Human)	WB	Human
Mostowy S, Bonazzi M, Hamon MA et al. Entrapment of intracytosolic bacteria by septin cage-like structures. Cell Host Microbe 2010 Nov 18 [PMID: 21075354]
Huang J, Birmingham CL, Shahnazari S et al. Antibacterial autophagy occurs at PI(3)P-enriched domains of the endoplasmic reticulum and requires Rab1 GTPase Autophagy 2011 Jan [PMID: 20980813] (WB, Human)	WB	Human
Fujimoto K, Ford EL, Tran H et al. Loss of Nix in Pdx1-deficient mice prevents apoptotic and necrotic beta cell death and diabetes. J Clin Invest 2010 Nov [PMID: 20978346] (WB, Mouse)	WB	Mouse
Yoon S, Woo SU, Kang JH et al. STAT3 transcriptional factor activated by reactive oxygen species induces IL6 in starvation-induced autophagy of cancer cells. Autophagy 2010 Nov [PMID: 20930550] (ELISA, Human)	ELISA	Human
Li X, Lu Y, Pan T, Fan Z. Roles of autophagy in cetuximab-mediated cancer therapy against EGFR. Autophagy 2010 Nov [PMID: 20864811] (WB, Human)	WB	Human
Fukaya T, Takagi H, Sato Y et al. Crucial roles of B7-H1 and B7-DC expressed on mesenteric lymph node dendritic cells in the generation of antigen-specific CD4+Foxp3+ regulatory T cells in the establishment of oral tolerance. Blood 2010 Sep 30 [PMID: 20574047] (WB, Mouse)	WB	Mouse
He C, Klionsky DJ. Analyzing autophagy in zebrafish. Autophagy 2010 Jul [PMID: 20495344] (WB)	WB
Zhou X, Wang L, Hasegawa H et al. Deletion of PIK3C3/Vps34 in sensory neurons causes rapid neurodegeneration by disrupting the endosomal but not the autophagic pathway. Proc Natl Acad Sci U S A;107(20):9424-9. 2010 May 18. [PMID: 20439739] (WB, Mouse)	WB	Mouse
Spilman P, Podlutskaya N, Hart MJ, Debnath J, Gorostiza O, Bredesen D, Richardson A, Strong R, Galvan V. Inhibition of mTOR by rapamycin abolishes cognitive deficits and reduces amyloid-beta levels in a mouse model of Alzheimer's disease. PLoS One;5(4):e9979. 2010 Apr 1. [PMID: 20376313]
Pankow JF. Organic particulate material levels in the atmosphere: conditions favoring sensitivity to varying relative humidity and temperature. Proc Natl Acad Sci U S A 2010 Apr 13 [PMID: 20368456]
Li X, Wang CE, Huang S et al. Inhibiting the ubiquitin-proteasome system leads to preferential accumulation of toxic N-terminal mutant huntingtin fragments. Hum Mol Genet 2010 Jun 15 [PMID: 20354076] (WB)	WB
Barth S, Glick D, Macleod KF. Autophagy: assays and artifacts. J Pathol;221(2):117-24. 2010 Jun. [PMID: 20225337]
Kuo HP, Lee DF, Chen CT et al. ARD1 stabilization of TSC2 suppresses tumorigenesis through the mTOR signaling pathway. Sci Signal 2010 [PMID: 20145209]
D'Eletto M, Farrace MG, Falasca L et al. Transglutaminase 2 is involved in autophagosome maturation. Autophagy 2009 Nov [PMID: 19955852] (WB, Mouse)	WB	Mouse
Zwerger M, Kolb T, Richter K et al. Induction of a massive endoplasmic reticulum and perinuclear space expansion by expression of lamin B receptor mutants and the related sterol reductases TM7SF2 and DHCR7. Mol Biol Cell 2010 Jan 15 [PMID: 19940018] (WB, Human)	WB	Human
Bensaad K, Cheung EC, Vousden KH. Modulation of intracellular ROS levels by TIGAR controls autophagy. EMBO J 2009 Oct 7 [PMID: 19713938] (Human)		Human
Fujimoto K, Hanson PT, Tran H et al. Autophagy Regulates Pancreatic Beta Cell Death in Response to Pdx1 Deficiency and Nutrient Deprivation. J Biol Chem;284(40):27664-27673. 2009 [PMID: 19654319]
Pujol C, Klein KA, Romanov GA et al. Yersinia pestis Can Reside in Autophagosomes Avoid Xenophagy in Murine Macrophages by Preventing Vacuole Acidification. Infect Immun;77(6):2251-2261. 2009 [PMID: 19289509]
He C, Bartholomew CR, Zhou W et al. Assaying autophagic activity in transgenic GFP-Lc3 and GFP-Gabarap zebrafish embryos. Autophagy 2009 May [PMID: 19221467] (WB)	WB
Swanson MS, Byrne BG, Dubuisson JF. Kinetic analysis of autophagosome formation and turnover in primary mouse macrophages. Methods Enzymol 2009 [PMID: 19200894] (Mouse)		Mouse
Lee IH, Finkel T. Regulation of Autophagy by the p300 Acetyltransferase. J Biol Chem;284(10):6322-6328. 2009 [PMID: 19124466]
Swerdlow S, McColl K, Rong Y, Lam M, Gupta A, Distelhorst CW. Apoptosis inhibition by Bcl-2 gives way to autophagy in glucocorticoid-treated lymphocytes. Autophagy;4(5):612-20. 2008 Jul 1. [PMID: 18362516]
Lee IH, Cao L, Mostoslavsky R, Lombard DB, Liu J, Bruns NE, Tsokos M, Alt FW, Finkel T. A role for the NAD-dependent deacetylase Sirt1 in the regulation of autophagy. Proc Natl Acad Sci U S A;105(9):3374-9. 2008 Mar 4. [PMID: 18296641]
Mercer CA, Kaliappan A, Dennis PB et al. Macroautophagy-dependent, intralysosomal cleavage of a betaine homocysteine methyltransferase fusion protein requires stable multimerization. Autophagy 2008 Feb [PMID: 18059170] (WB, Human)	WB	Human
Zhang L, Yu J, Pan H, Hu P, Hao Y, Cai W, Zhu H, Yu AD, Xie X, Ma D, Yuan J. Small molecule regulators of autophagy identified by an image-based high-throughput screen. Proc Natl Acad Sci U S A;104(48):19023-8. 2007 Nov 27. [PMID: 18024584]
Kuo HP, Lee DF, Chen CT et al. ARD1 stabilization of TSC2 suppresses tumorigenesis through the mTOR signaling pathway. Sci Signal;3(108):ra9. 2010 Feb 9. [PMID: 2014520]
Karanasios E, Ktistakis NT. Studying Autophagy: List of Useful Antibodies Produced via a Community Effort. Autophagy at the Cell, Tissue and Organismal Level. 2016 Apr 24
Nie X, Nishitani C, Yamazoe M et al. Pulmonary surfactant protein D binds MD-2 through the carbohydrate recognition domain. Biochemistry 2008 Dec 2 [PMID: 18991397] (Human)		Human
Show All 209 Publications. Collapse Publications.

Reviews for LC3A Antibody (NB100-2331) (18) 4.318

Average Rating: 4.3 (Based on 18 reviews) We have 18 reviews tested in 4 species: Human, Mouse, Mouse and Human, Other. Submit a Review Reviews using NB100-2331: Filter by Applications WB (15) IF (1) IHC-P (1) IHC (1) All Applications Filter by Species Human (8) Mouse (7) Mouse and Human (1) Other (1) All Species

Images

Ratings

Applications

Species

Date

Details

Enlarge

reviewed by:Anonymous

Mouse and Human

11/25/2017

View

Summary

Application	Western Blot
Sample Tested	mouse hepatocytes and HepG2 cells
Species	Mouse and Human
Lot	AC-1

Enlarge

reviewed by:Anonymous

Mouse

08/07/2017

View

Summary

Application	Western Blot
Sample Tested	Mouse macrophage cell line RAW 264.7
Species	Mouse
Lot	H6-NB100-2331

reviewed by:jennifer guadagno

Mouse

10/06/2015

View

Summary

Application	Western Blot
Sample Tested	Mouse Neuro2A, Mouse Cortical Neurons whole cell lysate
Species	Mouse
Lot	R-4

Blocking

Blocking Details

10% non-fat dry milk in TBS-T (0.05% Tween) for 1hr at room temperature

Primary Anitbody

Dilution Ratio

1:1000

Secondary Antibody

Secondary Description	Goat-anti rabbit HRP
Secondary Concentration	1:5000 in 3% milk in TBS-T (0.05%)

Details

Detection Notes

Clarity ECL, Biorad Chemidoc imager, exposed for 1 min, Neg control= untreated cells, Pos Control= rapamycin

Comments

This antibody works very well. Very strong clear signal.

Enlarge

reviewed by:Anonymous

Human

01/12/2015

View

Summary

Application	Western Blot
Sample Tested	human glioblastoma
Species	Human

Blocking

Blocking Details

Li-Cor blockin bufffer

Primary Anitbody

Dilution Ratio

2 ug/ml, overnight, room temperature, TBST buffer

Secondary Antibody

Secondary Description	anti-IgG secondary antibodies, Conjugation: IRDyeÃ‚Â® 800CW
Secondary Manufacturer Cat#	Li-Cor
Secondary Concentration	per vendor recomendations

Details

Detection Notes

Odyssey Li-Cor

Comments

Please site our paper:Tamoxifen improves cytopathic effect of oncolytic adenovirus in primary glioblastoma cells mediated through autophagy." just accepted for Oncotarget.

reviewed by:Anonymous

Mouse

12/12/2014

View

Summary

Application	Western Blot
Sample Tested	See PMID 22892563
Species	Mouse

Blocking

Blocking Details

See PMID 22892563

Details

Detection Notes

See PMID 22892563

Comments

Published in PMID: 22892563

Enlarge

reviewed by:Anonymous

Mouse

11/25/2014

View

Summary

Application	Immunofluorescence
Sample Tested	NIH3T3, HeLa, HEK293T, N2a neuroblastoma, Q7 striatal, Sy5Y neuroblastoma
Species	Mouse

Blocking

Blocking Details

1% BSA + 1%milk

Primary Anitbody

Dilution Ratio

1:100 for IF

Secondary Antibody

Secondary Description	Cy5 conjuagated anti-rabbit
Secondary Concentration	1:500

Details

Detection Notes	Images taken by Zeiss Axiovert microscope
Fixation Details	PFA Fixed, 0.1% Tween20 permeabilized, PBS, 1hr primary incubation at RT
Wash Description	PBS 3x washes, 2 mins each

Enlarge

reviewed by:Merissa Olmer

IHC-P

10/04/2014

View

Summary

Application	Immunohistochemistry-Paraffin
Lot	S-1
Comments	These tissue samples were fixed with zinc buffered formalin.

Enlarge

reviewed by:Ilya Ulasov

Human

06/30/2014

View

Summary

Application	Western Blot
Sample Tested	human tumor cells
Species	Human
Lot	q-1

Blocking

Blocking Details

#917-40000, LI-COR

Primary Anitbody

Dilution Ratio

in agreement with vendor recommendation

Secondary Antibody

Secondary Description	goat-anti-rabbit
Secondary Manufacturer Cat#	Li-COR

Details

Detection Notes

Odyssey Imaging System (Model #1866, Li-COR Biosciences

reviewed by:Anonymous

Human

06/20/2014

View

Summary

Application	Western Blot
Species	Human
Pub Med ID	24735980
File	View PDF

Enlarge

reviewed by:Kumsal Tekirdag

Human

04/02/2014

View

Summary

Application	Western Blot
Species	Human
Lot	S-2
Special Applications	Gives slighter LC3-I band compared to LC3II. Stronger binding to LC3II. High level of background at first usage in BSA solution.
Pub Med ID	24358205
File	View PDF

Enlarge

reviewed by:Nirmala Parajuli

IHC

Mouse

08/13/2012

View

Summary

Application	Immunohistochemistry
Sample Tested	Renal tissue (paraffin block)
Species	Mouse
Lot	N
Comments	Antibody is good for immunohistochemistry. But, since this is polyclonal, each lot has to be tested for concentration of primary antibody to get desired results.

Blocking

Blocking Details

Protein block, Dako, 20 min RT

Primary Anitbody

Dilution Ratio

1:10,000, 4dC, ON, 0.1%BSA plus0.05% skim milk

Secondary Antibody

Secondary Description	Goat anti-rabbit-HRP
Secondary Manufacturer Cat#	DAKO, #K4011
Secondary Concentration	DAKO kit

Details

Detection Notes	DAB, 5 min
Fixation Details	10% NBF, 10mM Sodium Citrate buffer pH6.0
Wash Description	TBS-T, 5 min X 4

Comments

Antibody is good for immunohistochemistry. But, since this is polyclonal, each lot has to be tested for concentration of primary antibody to get desired results.

Enlarge

reviewed by:Anonymous

Human

12/28/2011

View

Summary

Application	Western Blot
Sample Tested	Human
Species	Human
Comments	Good antibody!

Blocking

Blocking Details

Blocking Buffer: 10% non-fat milk

Primary Anitbody

Dilution Ratio

Primary Ab Dilution Ratio: 1:1000, Primary Ab Incubation Time: overnight

Secondary Antibody

Secondary Description

Secondary Ab: rabbit

Details

Detection Notes

Detection Method: HRP

Comments

Good antibody!

reviewed by:Anonymous

Human

11/21/2011

View

Summary

Application	Western Blot
Sample Tested	Human
Species	Human

Blocking

Blocking Details

Blocking Buffer: 5% Milk

Primary Anitbody

Dilution Ratio

Primary Ab Dilution Ratio: 1:1000, Primary Ab Incubation Time: overnight, Primary Ab Incubation Temp: 4 degrees Celsius

Secondary Antibody

Secondary Description

Secondary Ab Dilution Ratio: 1:5000

Details

Detection Notes

Detection Method: ECL-HRP

reviewed by:Anonymous

Human

11/21/2011

View

Summary

Application	Western Blot
Sample Tested	Human
Species	Human

Blocking

Blocking Details

Blocking Buffer: 2% Skim Milk

Primary Anitbody

Dilution Ratio

Primary Ab Dilution Ratio: 1:1000, Primary Ab Incubation Time: overnight, Primary Ab Incubation Temp: 4 degrees Celsius

Secondary Antibody

Secondary Description

Secondary Ab: Goat anti-rabbit HRP

Details

Detection Notes

Detection Method: ECL

reviewed by:Anonymous

Mouse

10/24/2011

View

Summary

Application	Western Blot
Sample Tested	Mouse
Species	Mouse
Comments	The antibody worked well!

Blocking

Blocking Details

Blocking Buffer: 5% Milk

Primary Anitbody

Dilution Ratio

Primary Ab Dilution Ratio: 1:5000, Primary Ab Incubation Time: 16 hours

Secondary Antibody

Secondary Description

Secondary Ab: anti-mouse HRP antibody

Details

Detection Notes

Detection Method: ECL

Comments

The antibody worked well!

reviewed by:Seung-Hyun Ro

Mouse

07/08/2010

View

Summary

Application	Western Blot
Sample Tested	3T3-L1 adipocyte, Sample Amount: 30ug
Species	Mouse
Lot	H2
Comments	I used in for 3T3-L1 mouse adipocyte and it is working great.

Blocking

Blocking Details

Blocking Buffer: 5% Milk in PBST, Blocking Time: 1 hour, Blocking Temp: Room temperature

Primary Anitbody

Dilution Ratio

Dilution Ratio: 1:1000, Incubation Dilution Buffer: PBST, Incubation Time: 2 hours, Incubation Temp: room temperature

Secondary Antibody

Secondary Description	Secondary Ab: Rabbit, Secondary Ab Dilution Ratio: 1:3000
Secondary Manufacturer Cat#	Santa Cruz sc-2077

Details

Detection Notes

Detection Method: ECL - perkin elmer, Exposure Time: 1 minute, Positive Control: Actin, Specific Bands: 15, 18 kDa

Comments

I used in for 3T3-L1 mouse adipocyte and it is working great.

Enlarge

reviewed by:Anonymous

Other

11/05/2009

View

Summary

Application	Western Blot
Sample Tested	lysed cell lines, Sample Amount: 20 ug
Species	Other
Lot	J

Blocking

Blocking Details

Blocking Buffer: TBS 0.1% Tween20 5% NFDM, Blocking Time: 1 hour, Blocking Temp: Room temperature

Primary Anitbody

Dilution Ratio

Dilution Concentration: 0.002, Incubation Dilution Buffer: TBS 0.1% Tween20 5% NFDM, Incubation Time: 1 hr, Incubation Temp: RT

Secondary Antibody

Secondary Description

Secondary Ab: Goat anti-Rabbit HRP, Secondary Ab Dilution Ratio: 1/4000

Details

Detection Notes

Detection Method: Super Signal West Dura, Exposure Time: 1 minute, Specific Bands: 19 and 17kDa doublet

reviewed by:Anonymous

Human

02/18/2009

View

Summary

Application	Western Blot
Sample Tested	Human cancer cells, Sample Amount: 80ug
Species	Human
Lot	SS

Blocking

Blocking Details

Blocking Buffer: 5% Milk in PBST, Blocking Time: 30 minutes, Blocking Temp: Room temperature

Primary Anitbody

Dilution Ratio

Primary Ab Incubation Time: overnight, Primary Ab Incubation Temp: 4 degrees Celsius

Details

Detection Notes

Detection Method: Licor, Exposure Time: 2 minutes, Specific Bands: 17 and 19 kDa

Product General Protocols

View specific protocols for LC3A Antibody (NB100-2331):

Western Blot protocol specific for LC3 Antibody (NB100-2331)

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Western Blot
Immunoprecipitation
Immunohistochemistry-Frozen
Immunohistochemistry-Paraffin
ELISA
Immunocytochemistry/Immunofluorescence
Flow Cytometry
View all Protocols, Troubleshooting, Illustrated assays and Webinars.

Video Protocols

WB Video Protocol ICC/IF Video Protocol

FAQs for LC3A Antibody (NB100-2331). (Showing 1 - 3 of 3 FAQs).

May we ask if it is possible to perform IF to stain LC3-I and LC3-II separately with two different fluorescent colors?
- Yes, it is possible to perform IF stain for LC3-I and LC3-II separately with two different fluorescent colors! You will have to use two different primary antibodies and in order to avoid any potential background/cross reactivity issues, I would suggest that you employ conjugated primary antibodies for the testing. 1. Our LC3I antibody (NBP1-78964) has been designed to specifically detect the cytosolic form of the LC3 protein which is actually LC3 I (Note: LC3-II binds to the autophagic membranes). 2. There is not even a single antibody to our knowledge that would exclusively detect the LC3 II form, and you would have to detect LC3II/ autophagic membranes form with an antibody which detects LC3 I/LC3II together. Therefore you may opt second antibody from one of the followings: LC3 Antibody (NB100-2220), LC3 Antibody (NB100-2331), LC3 Antibody (NBP1-19167). All of these mentioned catalog #s come with different options for their conjugated forms and you may select appropriate conjugated forms for performing the IF staining using our explained criteria.
I am interested in detecting the LC3 protein in the sea anemone Aiptasia. I have used your LC3 antibody (NB100-2331) and got a band in my Western blot at around 15 kD, which seems reasonable. However I would like to know how likely it is that your antibody binds to the LC3 protein of Aiptasia? Unfortunately I could not find the protein sequence against which the LC3 antibody was raised to and am hoping you could help me. The protein sequence for the Aiptasia LC3 is: MGDNNVLSYKPFKQRKSFVSRRDEVAGIRAKFPSKVPVIVERYHKERDLPLLDKTKFLVPQELTMSQFVTIIRNRMSLSS TQAFYLIVNNKSLASMSMTMAELYREEKDEDGFLYMVYASQEMFGCNS
- In comparing the sequences of the human LC3 and Aiptasia proteins, and it seems as though there is very low homology. There is only 62% sequence similarity, and we generally don't recommend antibodies for novel species unless they have at least 85%. There is a chance that it will work, but we cannot guarantee it.
Do you have any data or reason to believe the your LC3 antibody (NB100-2331) has a higher affinity to LC3-II than to LC3-I?
- No, we do not have any data or reason to believe that NB100-2331 has a higher affinity to LC3-II than to LC3-I. This antibody was raised using a synthetic peptide made to an internal portion of the human LC3 protein sequence (between residues 25-121) as an immunogen and is expected to detect both LC3-I as well as LC3-II, and their signal will depend upon their respective amounts being present in your samples at the time of detection.

Positive Control Lysate(s)

LC3B Overexpression Lysate (Native)
Mouse Brain Whole Tissue Lysate (Adult Whole Normal)
Human Brain Whole Tissue Lysate (Adult Whole Normal)
Neuro2a Whole Cell Lysate
Neuro2a Chloroquine Treated / Untreated Cell Lysate
HeLa Chloroquine Treated / Untreated Cell Lysate

Secondary Antibodies

Anti-Rabbit HRP Labeled Antibodies
Anti-Rabbit FITC Labeled Antibodies
Anti-Rabbit Biotin Labeled Antibodies
Â
View all of our anti-Rabbit Secondary Antibodies

Isotype Controls

Rabbit Isotype Controls
Â
View all of our Isotype Control Products

Other Available Formats

Alexa Fluor 405 Labeled	NB100-2331AF405
Alexa Fluor 488 Labeled	NB100-2331AF488
Alexa Fluor 647 Labeled	NB100-2331AF647
Alexa Fluor 700 Labeled	NB100-2331AF700
Biotin Labeled	NB100-2331B
DyLight 405 Labeled	NB100-2331V
DyLight 488 Labeled	NB100-2331G
DyLight 550 Labeled	NB100-2331R
DyLight 650 Labeled	NB100-2331C
FITC Labeled	NB100-2331F
HRP Labeled	NB100-2331H

Learn about Custom Antibody Labeling

Additional Array Products

LC3A Antibodies
LC3A Lysates
LC3A Proteins
LC3A RNAi
LC3A Proteins and Enzymes

Bioinformatics Tool for LC3A Antibody (NB100-2331)

Discover related pathways, diseases and genes to LC3A Antibody (NB100-2331). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.

Diseases for LC3A Antibody (NB100-2331)

Discover more about diseases related to LC3A Antibody (NB100-2331).

Neoplasms
Carcinoma
Malignant Neoplasms
Adenocarcinoma
Neoplasm Metastasis
Malignant Neoplasm Of Breast
Mammary Neoplasms
Streptococcal Lymphadenitis Of Swine
Endometrial Polyp
Malignant Squamous Cell Neoplasm
Endometrial Carcinoma
Sclerosis
Laryngeal Squamous Cell Carcinoma
Melanoma
Polyps
Dementia
Glioma
Hypoxia
Neoplasm Invasiveness
Immunologic Deficiency Syndromes

Pathways for LC3A Antibody (NB100-2331)

View related products by pathway.

Autophagy
Cell Death
Localization
Pathogenesis
Programmed Cell Death
Dna Methylation
Pigmentation
Oocyte Maturation
Conjugation
Methylation
Macroautophagy
Cell Cycle
Cell Growth
Viral Replication
Rna Interference
Â

PTMs for LC3A Antibody (NB100-2331)

Learn more about PTMs related to LC3A Antibody (NB100-2331).

Cleavage
Phosphorylation
Methylation
Ubiquitination

Research Areas for LC3A Antibody (NB100-2331)

Find related products by research area.

Autophagy
Cancer
Cellular Markers
Cytoskeleton Markers
Hypoxia
Macroautophagy
Signal Transduction

Blogs on LC3A.

Check out the latest blog posts on LC3A.

Nuclear LC3: Why is it there and what is it doing? By Christina Towers, PhD. Cells use the complex process of autophagy to degrade and recycle cytoplasmic material.Ã‚Â There are over 20 proteins that have been implicated in this process and appropriately named core...Â Â Read full blog post.